PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000683389
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NF-YB
Protein Properties Length: 193aa    MW: 21538.4 Da    PI: 9.5467
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000683389genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB156.44.8e-4952147297
          NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 
                    +eqd +lPianv+rimk++lP +akisk+ak+t+qec++ef+sfvt+easdkc++e+rkt+ngdd++wal+ lGf++y+++   yl+kyre+e++k
  MDP0000683389  52 QEQDGMLPIANVGRIMKQILPPRAKISKEAKQTMQECATEFLSFVTGEASDKCHKENRKTVNGDDICWALSALGFDNYAQAAMRYLHKYRETERDK 147
                    69********************************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.3E-4749170IPR009072Histone-fold
SuperFamilySSF471132.1E-3754171IPR009072Histone-fold
PfamPF008083.1E-2558121IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006153.2E-1685103No hitNo description
PRINTSPR006153.2E-16104122No hitNo description
PRINTSPR006153.2E-16123141No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 193 aa     Download sequence    Send to blast
MRPKDNGTNQ ARKAQLRLSA PGLIKQRVCV RKDQSTPPKS NCMDQSINMV DQEQDGMLPI  60
ANVGRIMKQI LPPRAKISKE AKQTMQECAT EFLSFVTGEA SDKCHKENRK TVNGDDICWA  120
LSALGFDNYA QAAMRYLHKY RETERDKAAA NNNQNTANIT SHGGLQVREQ TQTSNLEFRV  180
LEKGDNSLIT KP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B5e-3952142292Transcription factor HapC (Eurofung)
4g92_B5e-3952142292Transcription factor HapC (Eurofung)
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00133DAPTransfer from AT1G09030Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009376649.11e-106PREDICTED: nuclear transcription factor Y subunit B-4
SwissprotO040275e-55NFYB4_ARATH; Nuclear transcription factor Y subunit B-4
TrEMBLB9I7Q32e-66B9I7Q3_POPTR; Uncharacterized protein
STRINGPOPTR_0013s02030.15e-66(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF80532131
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09030.15e-54nuclear factor Y, subunit B4